PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopim09g011380.0.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family TALE
Protein Properties Length: 505aa    MW: 55977.5 Da    PI: 7.8888
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopim09g011380.0.1genomeCSHLView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.91.9e-093013332254
                         SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
            Homeobox  22 nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                         ++yp+ +++  LAk++gL+ +qV++WF N R +
  Sopim09g011380.0.1 301 HPYPTDTDKVMLAKQTGLSRNQVSNWFINARVR 333
                         89*****************************88 PP

2BELL104.19.8e-34173241472
                BELL   4 elqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                         +  kkk++L+s+l+eV+++Ykqy+eqlq+v++sFe vaglg+a+p++++A k++S+hF+cLkdai++q+
  Sopim09g011380.0.1 173 QFGKKKSRLISMLDEVYHKYKQYHEQLQMVVASFESVAGLGNAAPFANVAIKTMSKHFKCLKDAIIDQL 241
                         5679**************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005744.7E-43118239IPR006563POX domain
PfamPF075263.1E-34123237IPR006563POX domain
PROSITE profilePS5007111.953274337IPR001356Homeobox domain
SMARTSM003898.6E-10277341IPR001356Homeobox domain
CDDcd000863.48E-12277338No hitNo description
SuperFamilySSF466893.64E-17279343IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.6E-27280341IPR009057Homeodomain-like
PfamPF059201.1E-18294333IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010051Biological Processxylem and phloem pattern formation
GO:0010076Biological Processmaintenance of floral meristem identity
GO:0010077Biological Processmaintenance of inflorescence meristem identity
GO:0010089Biological Processxylem development
GO:0010154Biological Processfruit development
GO:0010223Biological Processsecondary shoot formation
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0048457Biological Processfloral whorl morphogenesis
GO:0048645Biological Processorgan formation
GO:0080006Biological Processinternode patterning
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 505 aa     Download sequence    Send to blast
MAEGFEPYHV PQQSRRDKLR VLLDENNNSN CQIPPLYDPS IVLSSDLSIF QEINGNPFLY  60
TSQIPRFLDH NNTNTNSNSN SNGQGNLSLS LSSLHNNDLS SSKSITTTTS CVPLGPFTGY  120
SSILKRSKFL KPAQILLDEL CHVTKGIYVD DSNDDASNLM MDTPQGFTNG EEQFGKKKSR  180
LISMLDEVYH KYKQYHEQLQ MVVASFESVA GLGNAAPFAN VAIKTMSKHF KCLKDAIIDQ  240
LQFTTRKSSH GQINCERGVG ISGKGIYCQR QETQPVWRPQ RGLPERAVTV LRAWLFDHFL  300
HPYPTDTDKV MLAKQTGLSR NQVSNWFINA RVRLWKPMVE EIHMLETREG HNKSSSHREG  360
PNNNNNNDSN NPIEHFPMSN SNACESNTPS TSTSRLQDLP SKRTRNELTN IPNNIGRIAD  420
SINLSYGNLS TGVGGGVSLT LGLHQNSGNI GLSEPFPMNA ARRFGIDSST SSGRVIFGGF  480
DEQNGQFGRN NSMVGGQFLH DFAG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4xrs_A7e-16283340158Homeobox protein Meis1
4xrs_B7e-16283340158Homeobox protein Meis1
5bng_A7e-16283341159Homeobox protein Meis2
5bng_B7e-16283341159Homeobox protein Meis2
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755210.0HG975521.1 Solanum lycopersicum chromosome ch09, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004246395.10.0PREDICTED: BEL1-like homeodomain protein 9
SwissprotQ9LZM81e-108BLH9_ARATH; BEL1-like homeodomain protein 9
TrEMBLK4CRG40.0K4CRG4_SOLLC; Uncharacterized protein
STRINGSolyc09g011380.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA35202237
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G02030.13e-96TALE family protein